PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr013108.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 390aa    MW: 43798 Da    PI: 4.527
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr013108.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM60.55.7e-1981442127
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkk.leleev.ikevdi..ykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknr.atksgyWk...at 86 
                  p GfrF+Ptd+elv ++L + +e+ +  +l ++ i+ ++i  +k+eP+++ +     +++ ++  +yfF++ ++ +++g++  r + + g+W    at
  Pbr013108.1   8 PFGFRFKPTDQELVGHFLYNFLENIPlAPLYNTlIHGCNIfgNKSEPSEIWEayggtQLADDQPALYFFTELKRLNPKGTNIDRkMGRGGTWTgkaAT 105
                  89**********************9974444445****9944588*****7435554444455588******************6677999*733344 PP

          NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                   + + +++ + +++glk+t+ + ++   +  + +W+++ey+
  Pbr013108.1 106 VRVEGIVDGRPTDIGLKRTFRYKNE--GSEDHKRWLLDEYS 144
                  4455555558888********9843..3335789******7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-216170IPR003441NAC domain
PROSITE profilePS5100522.9457170IPR003441NAC domain
PfamPF023651.3E-148144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MENNSLVPFG FRFKPTDQEL VGHFLYNFLE NIPLAPLYNT LIHGCNIFGN KSEPSEIWEA  60
YGGTQLADDQ PALYFFTELK RLNPKGTNID RKMGRGGTWT GKAATVRVEG IVDGRPTDIG  120
LKRTFRYKNE GSEDHKRWLL DEYSHFAGPR NNKSNFSYDF NVALCRLRKK EGSRINKRMC  180
STSSLSKDQL PNSKKQRSTN KKMKKEDDQV VSKGSSSQNI NVINLAEEEA PQGSSCLSSE  240
IVAVREINKF TDADDVVYDH DLLDETLTVD ELLPVLEASG IVSGEAVEEQ ALNPIMLEEY  300
TPETQKLPLP AAAVVAADGA VGQKAWDPSL LDEYWLAETQ QEPFPTMTGM FPYLEEACNP  360
SSFENVVDQS LFDINYWNNS FMDDQFMPP*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009358388.10.0PREDICTED: uncharacterized protein LOC103949021
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15308210
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32510.16e-10NAC domain containing protein 11